Endocrine

CJC-1295 + Ipamorelin

CJC-1295 and Ipamorelin represent two structurally distinct peptide classes that are frequently studied together in preclinical research due to their complementary mechanisms within the somatotropic a...

Bulk Pricing — Save More

Certificate of Analysis included with every order.

Technical Specifications

Purity≥99%
FormLyophilized powder
Storage-20°C
Molecular Weight3367.97 Da (CJC) / 711.85 Da (Ipa)
SequenceYADAIFTQSYRKVLAQLSARKLLQDIMSRQQGESNQERGARARL
CAS Number863288-34-0 / 170851-70-4

About This Peptide

CJC-1295 and Ipamorelin represent two structurally distinct peptide classes that are frequently studied together in preclinical research due to their complementary mechanisms within the somatotropic axis. CJC-1295 (CAS 863288-34-0) is a synthetic analogue of growth hormone-releasing hormone (GHRH), comprising a 30-amino acid sequence with the noted extension YADAIFTQSYRKVLAQLSARKLLQDIMSRQQGESNQERGARARL, engineered to resist enzymatic degradation via substitution at key cleavage sites and, in certain formulations, conjugation to a Drug Affinity Complex (DAC) that facilitates covalent binding to endogenous albumin. Ipamorelin (CAS 170851-70-4), a pentapeptide ghrelin mimetic with a molecular weight of 711.85 Da, acts as a selective growth hormone secretagogue receptor (GHSR-1a) agonist. Together, this combination—catalogued internally as CJC-1295 + Ipamorelin—is supplied as a lyophilized powder at ≥99% purity and is intended exclusively for laboratory and preclinical investigation.

The scientific rationale for studying CJC-1295 and Ipamorelin in combination stems from their distinct yet synergistic receptor targets. While CJC-1295 engages the GHRH receptor (GHRHR) on pituitary somatotrophs, Ipamorelin acts at the ghrelin receptor, providing a dual-pathway approach to eliciting growth hormone (GH) release in vitro and in animal models. This dual-receptor engagement has made the combination a widely referenced tool in research paradigms focused on GH secretion dynamics, pulsatile hormone signaling, and downstream IGF-1 pathway modulation. The molecular weight of CJC-1295 is 3367.97 Da, placing it in the mid-range peptide category suitable for receptor-binding and cell-based assays.

Both peptides are classified as research-grade compounds and are used across a range of in vitro cell culture systems and preclinical animal studies. CJC-1295 and Ipamorelin, when examined together, offer researchers a controlled model for dissecting the additive or synergistic effects of simultaneous GHRH and ghrelin receptor co-activation. Storage at −20°C in lyophilized powder form ensures stability across extended research timelines. For research use only. Not for human consumption.

Research Applications

≥99% purity. Lyophilized powder. Storage: -20°C. For research purposes only.

Mechanism of Action

CJC-1295 functions by binding to and activating the GHRH receptor (GHRHR), a Gs protein-coupled receptor expressed on anterior pituitary somatotrophs. This interaction stimulates adenylyl cyclase, elevating intracellular cyclic AMP (cAMP) concentrations, which in turn activates protein kinase A (PKA) and promotes calcium influx via voltage-gated channels. The downstream effect in experimental models is the stimulation of growth hormone gene transcription and pulsatile GH secretion. The DAC modification in CJC-1295 extends its half-life in biological matrices by enabling reversible covalent binding to serum albumin, making it a useful tool for studies requiring sustained GHRH receptor engagement without frequent re-dosing in animal protocols.

Ipamorelin operates through a mechanistically independent pathway, selectively agonizing the growth hormone secretagogue receptor type 1a (GHSR-1a), a Gq/11-coupled GPCR. GHSR-1a activation triggers phospholipase C (PLC)-mediated hydrolysis of phosphatidylinositol 4,5-bisphosphate (PIP₂), generating inositol trisphosphate (IP₃) and diacylglycerol (DAG), which mobilize intracellular calcium stores and activate protein kinase C (PKC). Notably, Ipamorelin exhibits high selectivity for GHSR-1a relative to other secretagogue receptors, producing minimal off-target effects on cortisol or prolactin release in preclinical models—a property that makes it a well-characterized research tool for isolating GH secretagogue activity. When CJC-1295 and Ipamorelin are used in combination in experimental settings, the cAMP and IP₃/DAG pathways converge at the level of intracellular calcium elevation, producing an amplified and more physiologically representative GH release profile than either peptide alone.

Research Applications

CJC-1295 and Ipamorelin are employed across a range of preclinical and in vitro research contexts, particularly in studies requiring modulation of the GH/IGF-1 axis. The following represent documented research application areas for this peptide combination:

  • Pituitary cell signaling studies: Investigation of cAMP and IP₃ second messenger pathway crosstalk in primary pituitary somatotroph cultures or GH3 cell lines following dual GHRHR and GHSR-1a activation.
  • GH secretion kinetics: Characterization of pulsatile GH release profiles in rodent models, including amplitude, frequency, and duration of secretory bursts under combinatorial peptide stimulation.
  • IGF-1 axis modulation: Preclinical assessment of hepatic IGF-1 mRNA expression and circulating IGF-1 levels following administration of CJC-1295 and Ipamorelin in rodent cohorts.
  • Receptor selectivity profiling: Comparative binding and functional assays to evaluate GHSR-1a vs. GHRHR selectivity, off-target receptor interactions, and signal bias using radioligand displacement or BRET-based approaches.
  • Metabolic parameter research: Examination of body composition endpoints (lean mass, adipose tissue distribution) and metabolic biomarkers in diet-induced or genetic animal models within IACUC-approved protocols.
  • Peptide half-life and pharmacokinetic modeling: In vitro plasma stability assays and in vivo PK studies assessing the influence of DAC albumin binding on the tissue distribution and elimination of CJC-1295 relative to unmodified GHRH analogues.

Storage & Handling Guidelines

Proper storage and handling are essential to maintain peptide integrity and ensure reliable research results. All Pepitiva Biolabs peptides are supplied as lyophilized (freeze-dried) powder, which provides excellent long-term stability when stored correctly. Store lyophilized peptides at -20°C for long-term storage or 2-8°C for short-term use. Once reconstituted, peptide solutions should be stored at 2-8°C and used within the timeframe specified in the product documentation. Always use sterile bacteriostatic water for reconstitution and handle peptides in a clean laboratory environment to prevent contamination. Avoid repeated freeze-thaw cycles, as thermal stress can cause peptide degradation and loss of biological activity.

Quality Control & Certification

This product is manufactured under strict quality control protocols and has been verified through comprehensive analytical testing. Each batch undergoes reverse-phase HPLC analysis for purity determination and electrospray ionization mass spectrometry (ESI-MS) for molecular identity confirmation. A detailed Certificate of Analysis (COA) is available for download, documenting purity percentage, molecular weight verification, appearance, and recommended storage conditions. Pepitiva Biolabs maintains batch-level traceability from synthesis through delivery, ensuring complete transparency and quality assurance for your research.

Frequently Asked Questions

Is this product approved for human use?

No. This product is intended exclusively for in vitro scientific research and laboratory use. It is not approved for human or veterinary use, not intended for diagnostic or therapeutic purposes, and should not be administered to humans or animals under any circumstances.

How do I reconstitute this peptide?

Add sterile bacteriostatic water slowly to the vial, directing the stream against the glass wall rather than directly onto the lyophilized powder. Gently swirl the vial until the powder is fully dissolved — do not shake vigorously. The recommended reconstitution volume depends on your desired concentration. Refer to the product documentation for specific guidance.

Can I get a Certificate of Analysis (COA)?

Yes. A Certificate of Analysis is included with every order and is also available for download from the product page. The COA documents HPLC purity, mass spectrometry identity confirmation, batch number, production date, and storage recommendations.

For research use only. Not for human consumption.

Related Peptides

≥98% AOD-9604
Metabolic

AOD-9604

AOD-9604 (CAS 221231-10-3) is a synthetic peptide fragment derived from the C-terminal region of hum...

from$70
AOD-9604
Best Seller ≥98% GLP-2T
Metabolic

Tirzepatide (GLP-2T)

Tirzepatide (internal code GLP-2T) is a synthetic 39-amino-acid dual-receptor agonist peptide with a...

from$120
GLP-2T
Best Seller ≥99% MOTS-c
Longevity

MOTS-c

MOTS-c (Mitochondrial Open Reading Frame of the Twelve S rRNA-c) is a mitochondria-derived peptide (...

from$55
MOTS-c