CJC-1295 + Ipamorelin
GH secretagogue combination for endocrine research.
Certificate of Analysis included with every order.
Technical Specifications
| Purity | ≥98% |
|---|---|
| Form | Lyophilized powder |
| Storage | -20°C |
| Molecular Weight | 3367.97 Da (CJC) / 711.85 Da (Ipa) |
| Sequence | YADAIFTQSYRKVLAQLSARKLLQDIMSRQQGESNQERGARARL |
| CAS Number | 863288-34-0 / 170851-70-4 |
About This Peptide
CJC-1295 is a synthetic GHRH analog with enhanced half-life due to Drug Affinity Complex (DAC) technology. Combined with Ipamorelin, a selective GH secretagogue, this peptide pair offers researchers a powerful tool for studying the growth hormone/IGF-1 axis without significant effects on cortisol or prolactin.
Research Applications
GH/IGF-1 axis, pulsatile GH release, GHRH receptor signaling, selective secretagogue research.
Mechanism of Action
CJC-1295 is a synthetic analog of growth hormone-releasing hormone (GHRH) modified with a Drug Affinity Complex (DAC) that extends its plasma half-life through albumin binding. Ipamorelin is a selective growth hormone secretagogue that activates the ghrelin receptor (GHSR) to stimulate pulsatile growth hormone release from the anterior pituitary. When combined, these two peptides engage complementary pathways: CJC-1295 amplifies the GHRH signaling cascade while Ipamorelin provides direct secretagogue stimulation, resulting in synergistic growth hormone elevation that more closely mimics physiological pulsatile GH release patterns compared to either compound alone.
Research Applications
The CJC-1295/Ipamorelin combination is employed in research investigating growth hormone axis physiology, pulsatile GH secretion patterns, IGF-1 pathway activation, and somatotroph cell function. Applications include studies of GH/IGF-1 axis regulation, growth hormone releasing hormone receptor pharmacology, ghrelin receptor signaling, body composition changes related to growth hormone status, and comparative analysis of different GH secretagogue combinations. This combination is also used in aging research and studies examining growth hormone decline in senescent models.
Storage & Handling Guidelines
Proper storage and handling are essential to maintain peptide integrity and ensure reliable research results. All Pepitiva Biolabs peptides are supplied as lyophilized (freeze-dried) powder, which provides excellent long-term stability when stored correctly. Store lyophilized peptides at -20°C for long-term storage or 2-8°C for short-term use. Once reconstituted, peptide solutions should be stored at 2-8°C and used within the timeframe specified in the product documentation. Always use sterile bacteriostatic water for reconstitution and handle peptides in a clean laboratory environment to prevent contamination. Avoid repeated freeze-thaw cycles, as thermal stress can cause peptide degradation and loss of biological activity.
Quality Control & Certification
This product is manufactured under strict quality control protocols and has been verified through comprehensive analytical testing. Each batch undergoes reverse-phase HPLC analysis for purity determination and electrospray ionization mass spectrometry (ESI-MS) for molecular identity confirmation. A detailed Certificate of Analysis (COA) is available for download, documenting purity percentage, molecular weight verification, appearance, and recommended storage conditions. Pepitiva Biolabs maintains batch-level traceability from synthesis through delivery, ensuring complete transparency and quality assurance for your research.
Frequently Asked Questions
Is this product approved for human use?
No. This product is intended exclusively for in vitro scientific research and laboratory use. It is not approved for human or veterinary use, not intended for diagnostic or therapeutic purposes, and should not be administered to humans or animals under any circumstances.
How do I reconstitute this peptide?
Add sterile bacteriostatic water slowly to the vial, directing the stream against the glass wall rather than directly onto the lyophilized powder. Gently swirl the vial until the powder is fully dissolved — do not shake vigorously. The recommended reconstitution volume depends on your desired concentration. Refer to the product documentation for specific guidance.
Can I get a Certificate of Analysis (COA)?
Yes. A Certificate of Analysis is included with every order and is also available for download from the product page. The COA documents HPLC purity, mass spectrometry identity confirmation, batch number, production date, and storage recommendations.
For research use only. Not for human consumption.