CJC-1295 + Ipamorelin
Growth hormone secretagogue combo
Login required to view pricing
Sign in or create an account to see pricing and add this product to your cart.
Certificate of Analysis included with every order.
Technical Specifications
| Purity | ≥99% |
|---|---|
| Form | Lyophilized powder |
| Storage | -20°C |
| Molecular Weight | 3367.97 Da (CJC) / 711.85 Da (Ipa) |
| Sequence | YADAIFTQSYRKVLAQLSARKLLQDIMSRQQGESNQERGARARL |
| CAS Number | 863288-34-0 / 170851-70-4 |
About This Peptide
Growth hormone secretagogue combo
Research Applications
≥99% purity. Lyophilized powder. Storage: -20°C. For research purposes only.
Storage & Handling Guidelines
Proper storage and handling are essential to maintain peptide integrity and ensure reliable research results. All Pepitiva Biolabs peptides are supplied as lyophilized (freeze-dried) powder, which provides excellent long-term stability when stored correctly. Store lyophilized peptides at -20°C for long-term storage or 2-8°C for short-term use. Once reconstituted, peptide solutions should be stored at 2-8°C and used within the timeframe specified in the product documentation. Always use sterile bacteriostatic water for reconstitution and handle peptides in a clean laboratory environment to prevent contamination. Avoid repeated freeze-thaw cycles, as thermal stress can cause peptide degradation and loss of biological activity.
Quality Control & Certification
This product is manufactured under strict quality control protocols and has been verified through comprehensive analytical testing. Each batch undergoes reverse-phase HPLC analysis for purity determination and electrospray ionization mass spectrometry (ESI-MS) for molecular identity confirmation. A detailed Certificate of Analysis (COA) is available for download, documenting purity percentage, molecular weight verification, appearance, and recommended storage conditions. Pepitiva Biolabs maintains batch-level traceability from synthesis through delivery, ensuring complete transparency and quality assurance for your research.
Frequently Asked Questions
Is this product approved for human use?
No. This product is intended exclusively for in vitro scientific research and laboratory use. It is not approved for human or veterinary use, not intended for diagnostic or therapeutic purposes, and should not be administered to humans or animals under any circumstances.
How do I reconstitute this peptide?
Add sterile bacteriostatic water slowly to the vial, directing the stream against the glass wall rather than directly onto the lyophilized powder. Gently swirl the vial until the powder is fully dissolved — do not shake vigorously. The recommended reconstitution volume depends on your desired concentration. Refer to the product documentation for specific guidance.
Can I get a Certificate of Analysis (COA)?
Yes. A Certificate of Analysis is included with every order and is also available for download from the product page. The COA documents HPLC purity, mass spectrometry identity confirmation, batch number, production date, and storage recommendations.
For research use only. Not for human consumption.